Overview

LL-37 is a 37-amino acid cationic antimicrobial peptide (AMP), the only known member of the cathelicidin family in humans. It is generated by proteolytic cleavage of the precursor protein hCAP-18 by serine proteases. LL-37 adopts a characteristic amphipathic alpha-helical structure in membrane environments that is critical for its membrane-disrupting antimicrobial activity. Beyond killing microbes, LL-37 has extensive immunomodulatory, wound-healing, and anti-cancer properties, making it a multifunctional innate immune molecule.

Mechanism of Action

LL-37's antimicrobial mechanism involves electrostatic interactions with negatively charged bacterial membranes (via its cationic charge), insertion into the lipid bilayer (facilitated by amphipathic helix), and pore formation and membrane disruption leading to bacterial cell death. It binds bacterial LPS (lipopolysaccharide), neutralizing endotoxin activity. Immunomodulatory effects include: chemotaxis of immune cells to infection sites; cytokine release modulation; enhancement of wound healing via promotion of cell migration and re-epithelialization; and angiogenesis promotion. It also demonstrates activity against enveloped viruses (influenza, HSV, RSV, HIV-1) through viral envelope disruption.

Potential Benefits

  • Broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria including MRSA
  • Antifungal activity against Candida albicans
  • Antiviral activity against enveloped viruses
  • Wound healing acceleration via re-epithelialization and angiogenesis
  • Immunomodulation guiding immune cells to infection sites
  • LPS neutralization reducing septic shock potential
  • Synergistic antimicrobial activity with beta-defensin-2 and lysozyme

Dosage Protocols

The following reflects doses used in published research studies. This is not medical advice. Consult a qualified healthcare professional.

Typical Range10-50 mcg/day topical; 100-200 mcg/day injectable (research)
Beginner25 mcg/day topically or 100 mcg/day subcutaneously
Intermediate50 mcg/day topically or 150 mcg/day subcutaneously
Advanced100-200 mcg/day subcutaneously; higher topical concentrations
Cycle Duration4-8 weeks
Cycle Off4 weeks

Primarily studied as a topical antimicrobial and wound healing agent. Injectable LL-37 is experimental. High systemic doses could cause off-target membrane disruption effects; use caution with injectable forms.

Routes of Administration

Topical Low

Primary therapeutic route for skin infections and wound healing; direct local antimicrobial activity; limited systemic absorption

Subcutaneous Injection High

Research use; systemic anti-inflammatory and immune-modulating effects; experimental dosing only

Stacking Protocols

Popular research stacks involving LL-37:

Wound Healing + Antimicrobial Stack

Infection-free accelerated wound closure

LL-37 provides antimicrobial protection while BPC-157 drives angiogenesis and GHK-Cu stimulates collagen matrix remodeling.

Immune Defense Stack

Multi-layer innate and adaptive immune enhancement

LL-37 handles pathogen defense; Thymosin Alpha-1 drives adaptive T-cell function; KPV provides anti-inflammatory modulation.

Reconstitution

Typical Vial Size2mg, 5mg
BAC Water1-2ml per 2mg vial
StorageRefrigerate at 2-8°C after reconstitution; topical formulations at room temperature
Shelf Life14-28 days refrigerated (injectable)

Need exact syringe measurements?

Amino Acid Sequence

LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES (37 amino acids)

Side Effects & Safety

  • Cytotoxicity to mammalian cells at high concentrations
  • Pro-inflammatory effects at certain concentrations (paradoxical)
  • Potential to promote bacterial resistance via virulence upregulation
  • Hemolytic activity at high doses

Synergistic Compounds

The following compounds have been studied alongside LL-37 for potential complementary or synergistic effects:

Beta-defensinsLysozymeBPC-157

Learn More

References & Further Reading

  • [object Object]
  • [object Object]
  • [object Object]